PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013904855.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family MYB
Protein Properties Length: 583aa    MW: 61309.2 Da    PI: 7.0336
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013904855.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.62.5e-121671148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT........TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg........kgRtlkqcksrwqkyl 48
                     +g W  eEde l  +v+  G g+W+ Iar ++        +gR +kqc++rw+ +l
   XP_013904855.1 16 KGGWRHEEDEALTTLVTHKGEGNWSEIARDLNrmvcgheeLGRVGKQCRERWNHHL 71
                     678*************************************************9886 PP

2Myb_DNA-binding46.67.9e-1577119145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT  E++ll + ++++G++ W+ I++ m+ gRt++ +k++w+
   XP_013904855.1  77 KTPWTLAEEQLLMQSHRRYGNR-WSEISKLMP-GRTENAIKNFWN 119
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.6831171IPR017930Myb domain
SuperFamilySSF466892.34E-2613118IPR009057Homeodomain-like
SMARTSM007174.1E-91573IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-201880IPR009057Homeodomain-like
PfamPF139214.9E-151988No hitNo description
CDDcd001678.45E-91971No hitNo description
PROSITE profilePS5129423.91472126IPR017930Myb domain
SMARTSM007173.7E-1576124IPR001005SANT/Myb domain
CDDcd001678.72E-1279122No hitNo description
Gene3DG3DSA:1.10.10.608.0E-2181125IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MSYAGGGRRE QPPMLKGGWR HEEDEALTTL VTHKGEGNWS EIARDLNRMV CGHEELGRVG  60
KQCRERWNHH LRPDINKTPW TLAEEQLLMQ SHRRYGNRWS EISKLMPGRT ENAIKNFWNA  120
TLRRKDITRG NNRNEIGVGL ALRAYMVDVG VALPTAPQPE YLPPQRRGPQ RPCPAPAAPR  180
WAATAARDGR RPDDGATAGG EDDYEEGDYE YGGGDDGYNK QDDDEAEDEA AGHAAAPELS  240
AFAAGHGIPA FRVPATKRRV SATGGGGSGG APDEGDSEAE WNPQHTGSPM AKAPLGAAAS  300
SGVHAPPPLS PLAGVPFLPA IPSPTKRPKP TAAGAHAHAI AHAAAAELRL SFPASEGAPR  360
PSQGSPAPSS GANTPLSLRR GSPPGAGLGV GLGSDGGSAA STGGAFQAGA GAPSAPIAPL  420
FSGVGLNVSQ ADLIAAFVAA LAQQAKAAQH TQQAPAAAQH AQLQQLQQHQ LMQQQALHQA  480
QQQAARQQRL EVAALQALAA QHLAQQQLFQ EQRARQQAAA QEQERVLMLQ LQQAARLAAM  540
GPGVKQDRGK PAAAVRGASD DEGEVESDAQ VAEMMLMLRN SGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C8e-361212554158MYB PROTO-ONCOGENE PROTEIN
1h89_C8e-361212554158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013904855.10.0Myb proto-oncoprotein
TrEMBLA0A0D2NMI30.0A0A0D2NMI3_9CHLO; Myb proto-oncoprotein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1516114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09370.11e-35myb domain protein 3r-3
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]